PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Manes.17G094500.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Euphorbiaceae; Crotonoideae; Manihoteae; Manihot
Family G2-like
Protein Properties Length: 401aa    MW: 44371.4 Da    PI: 6.6329
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Manes.17G094500.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like104.27.8e-33256311156
              G2-like   1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRla 56 
                          k+r++W+peLH+rFv+a++qLGGs+ AtPk+i+elm+v+gLt+++vkSHLQkYRl+
  Manes.17G094500.1.p 256 KQRRCWSPELHRRFVNALQQLGGSQTATPKQIRELMQVDGLTNDEVKSHLQKYRLH 311
                          79****************************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466891.61E-18253314IPR009057Homeodomain-like
PROSITE profilePS5129414.115253313IPR017930Myb domain
Gene3DG3DSA:1.10.10.606.8E-30254315IPR009057Homeodomain-like
TIGRFAMsTIGR015573.0E-27256311IPR006447Myb domain, plants
PfamPF002496.2E-8258309IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 401 aa     Download sequence    Send to blast
MGSLPPELSL DFRPTYVPKT ISDFLNEVSI IGDISEKVSK LDGFVKGLEE EMRKIDAFKR  60
ELPLCMLLLN DAILFLKAES TQCAASNNQP VLEEFIPLKT NCDDDDDEQD GPIKKEKDSK  120
DKKNWMSSVQ LWNSNDHHST DYIFDQKQNL KLESKTTKKG NQFANEDTFQ ACKGRSPART  180
FLPFKTYSGL SRKEDNDTSE ELPVPGLSLL TPGIKNLRAE SGSTRISCSR AVSSSAPNPQ  240
PNLRNGQPSQ QQTARKQRRC WSPELHRRFV NALQQLGGSQ TATPKQIREL MQVDGLTNDE  300
VKSHLQKYRL HTRRMPPATA ASANQSVVVL GGLWMSQDQY GDSSKTTSSQ SGSPQGPLQL  360
AGNTGGTSTT GGDSMEDDED AKSEGYSWKS HIHRSGKDDV *
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_012072452.10.0PREDICTED: probable transcription factor KAN3
TrEMBLA0A067L2E90.0A0A067L2E9_JATCU; Uncharacterized protein
STRINGPOPTR_0004s15220.10.0(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF120834107
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G03500.13e-57G2-like family protein